PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 245aa    MW: 29025.9 Da    PI: 10.1012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604711.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-132363848
                     HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     Ed ll+++++++G g+W+++ar  g++R +k+c++rw +yl
   XP_009604711.1 23 EDRLLIEYINLHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 63
                     9**************************************97 PP

2Myb_DNA-binding491.4e-1569113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+++++++++ +G++ W+tIar ++ gRt++++k++w+++
   XP_009604711.1  69 RGQITPYEEKIILELHAIWGNR-WSTIARGLP-GRTDNEIKNYWRTH 113
                      6788999***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4171263IPR017930Myb domain
SMARTSM007174.4E-91665IPR001005SANT/Myb domain
SuperFamilySSF466891.84E-2516110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-192270IPR009057Homeodomain-like
CDDcd001678.96E-82363No hitNo description
PfamPF002493.2E-122363IPR001005SANT/Myb domain
PROSITE profilePS5129423.79964118IPR017930Myb domain
SMARTSM007171.7E-1368116IPR001005SANT/Myb domain
PfamPF002492.4E-1369113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2471119IPR009057Homeodomain-like
CDDcd001679.99E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGEQMGNWRV IEEEWRKGPW IAEDRLLIEY INLHGEGRWN SVARLAGLKR NGKSCRLRWV  60
NYLRPDLKRG QITPYEEKII LELHAIWGNR WSTIARGLPG RTDNEIKNYW RTHFKKKVKK  120
SSTDKAEKTK ARLLKRQQFQ QQQQQQQLNN QNDMKRLASL FEEKENNRVP NLYSQGKQEM  180
AFLYQNTANQ EQGGGFFYST KASSKYEDII WDYGLWNLDD FNANLKIGAY YNSLPCMQTL  240
ATPFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-24911819128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604711.10.0PREDICTED: myb-related protein MYBAS2-like
TrEMBLM1CLG81e-105M1CLG8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000699551e-104(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-66myb domain protein 305